SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H3YTC2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H3YTC2
Domain Number 1 Region: 4-160
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 4.19e-66
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.00000118
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0H3YTC2
Sequence length 162
Comment (tr|A0A0H3YTC2|A0A0H3YTC2_PSEST) 5-(carboxyamino)imidazole ribonucleotide mutase {ECO:0000256|HAMAP-Rule:MF_01929} KW=Complete proteome OX=316 OS=Pseudomonas stutzeri (Pseudomonas perfectomarina). GN=AB691_0289 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSALVGVIMGSKSDWSTLSHTADMLEKLGIPHEVTVVSAHRTPDLLFQYAEQAEARGLRV
IIAGAGGAAHLPGMCAAKTHLPVLGVPVQSSMLSGVDSLLSIVQMPAGVPVATLAIGKAG
AINAALLSASILGHEFPEYHQALKKFRDEQTQTVLDNPDPRG
Download sequence
Identical sequences A0A0H3YTC2 A0A0T8L7H8 A0A1G3DA45 F2MXQ7 S6JKE3
gi|339492342|ref|YP_004712635.1| gi|386018903|ref|YP_005936927.1| WP_013981400.1.11668 WP_013981400.1.31855 WP_013981400.1.43901 WP_013981400.1.45895 WP_013981400.1.54801 WP_013981400.1.55002 WP_013981400.1.56336 WP_013981400.1.62806 WP_013981400.1.6831 WP_013981400.1.7470 WP_013981400.1.82288 WP_013981400.1.85630 WP_013981400.1.88125 WP_013981400.1.90639 WP_013981400.1.9384 WP_013981400.1.98540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]