SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H4HEA5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H4HEA5
Domain Number 1 Region: 178-279
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 1.19e-18
Family TolA 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0H4HEA5
Sequence length 279
Comment (tr|A0A0H4HEA5|A0A0H4HEA5_HAEDC) Protein TonB {ECO:0000256|RuleBase:RU362123} KW=Complete proteome OX=730 OS=Haemophilus ducreyi. GN=RZ68_01155 OC=Pasteurellaceae; Haemophilus.
Sequence
MKQKHSRIGLISSVFIHIVLFASFISLVEVSHSDLSDGDSPLSIELVAALLEQPQVAVAP
EEVTSTEPETFDEEPEPEQDAIPEPITKLIEKPKEKPKEKPKKPEKPKEKLKKEKPKEKA
KQIEALEKGPEAKQGIVAQAVPGALQGKKEQVGISNGNPNGNSASSSDTGLVNGMLGGNG
NGASSNEINAYKAALQRDLQHRANNAYPAREKMMRKTGVVTLGFTISPSGKLIDVTVLNS
SGNQNLDAAAVQAAEATKVAPPPIGFPPNVTVPIKFSIQ
Download sequence
Identical sequences A0A0H4HEA5
WP_064082526.1.16260 WP_064082526.1.19709 WP_064082526.1.45441 WP_064082526.1.70288 WP_064082526.1.79704

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]