SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H4KLJ4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H4KLJ4
Domain Number 1 Region: 11-59
Classification Level Classification E-value
Superfamily BAS1536-like 0.0000000000000876
Family BAS1536-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0H4KLJ4
Sequence length 78
Comment (tr|A0A0H4KLJ4|A0A0H4KLJ4_9BACI) Uncharacterized protein {ECO:0000313|EMBL:AKO94972.1} KW=Complete proteome; Reference proteome OX=135735 OS=Bacillus endophyticus. GN=BEH_04835 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MLQTYSDGKAEALLGEILHKRQEMCKLAEQKGYTHKDTIFCSQELDELLNRYQRCLEQKQ
EDKRPFFTILPTSLAFSK
Download sequence
Identical sequences A0A0H4KLJ4
WP_040058516.1.21832 WP_040058516.1.84906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]