SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H4PGZ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H4PGZ3
Domain Number 1 Region: 7-134
Classification Level Classification E-value
Superfamily YdhG-like 0.0000000000497
Family YdhG-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0H4PGZ3
Sequence length 151
Comment (tr|A0A0H4PGZ3|A0A0H4PGZ3_9BACT) Uncharacterized protein {ECO:0000313|EMBL:AKP53806.1} KW=Complete proteome OX=320787 OS=Cyclobacterium amurskyense. GN=CA2015_4465 OC=Cyclobacterium.
Sequence
MNSKTQSVEAYLDEIPDKRKEAFIKLREVINSNLPEGFEETMSYGMIGYIVPHKLYPAGY
HCNPKLPLPFVNLANQKNYIALYHLGIYANEELLNWFTTEYSKFSTTKLDMGKSCIRFKK
MDKIPYELIGKLMAKVSTQEWISTYENSIKK
Download sequence
Identical sequences A0A0H4PGZ3
WP_048643869.1.40132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]