SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H4RAU6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H4RAU6
Domain Number 1 Region: 28-124
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000129
Family SMI1/KNR4-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0H4RAU6
Sequence length 125
Comment (tr|A0A0H4RAU6|A0A0H4RAU6_BACME) Uncharacterized protein {ECO:0000313|EMBL:AKP76806.1} KW=Complete proteome OX=1452722 OS=Bacillus megaterium Q3. GN=AS52_01841 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MIKPDIEKIYKILKALPGTSVKVEFEDEVGEILSTPYYIYLKSEFLDGQLGYREDLEANS
LIGNQEGDWQESWFVIGYDEEIGGDPLFIDIANEDYPVFTAEHGMGEWDALEMYDSLEEF
VEDVT
Download sequence
Identical sequences A0A0H4RAU6
WP_033578685.1.47795 WP_033578685.1.56431 WP_033578685.1.95734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]