SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H4RDE3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H4RDE3
Domain Number 1 Region: 5-118
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000175
Family SMI1/KNR4-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0H4RDE3
Sequence length 184
Comment (tr|A0A0H4RDE3|A0A0H4RDE3_BACME) GAD-like domain protein {ECO:0000313|EMBL:AKP77706.1} KW=Complete proteome OX=1452722 OS=Bacillus megaterium Q3. GN=AS52_02745 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MNIYNDFRQSGTVEEETINKYKEHLPKELIEAWKTYGYGTLLNGYLKVINPDDFRELITD
TYLRNEGTIPIFATSMGDIILFEMDENNESYVVMVNYRKAKTKVLASKYSLFIRFLEEEP
FRQRSLEWSPYIKAVDHYELPAYDECFGYTPLLGLGGAEKVENLKKVKLKEHILIITEFM
GPVQ
Download sequence
Identical sequences A0A0H4RDE3
WP_034269054.1.47795 WP_034269054.1.95734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]