SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H4RFT0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H4RFT0
Domain Number 1 Region: 2-80
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000863
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0H4RFT0
Sequence length 85
Comment (tr|A0A0H4RFT0|A0A0H4RFT0_BACME) SMI1 / KNR4 family protein {ECO:0000313|EMBL:AKP77703.1} KW=Complete proteome OX=1452722 OS=Bacillus megaterium Q3. GN=AS52_02742 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MTKKEVENVEEKLGVKFPLDYIEVAIDYNGAHVSPELCQVEGKEKVFGKLLTYEVEDDEH
ILEVFNDYQDTLPKKLIPFALDLSL
Download sequence
Identical sequences A0A0H4RFT0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]