SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H4TF44 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0H4TF44
Domain Number - Region: 24-47
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0144
Family Mitotic arrest deficient-like 1, Mad1 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0H4TF44
Sequence length 49
Comment (tr|A0A0H4TF44|A0A0H4TF44_9CAUD) Uncharacterized protein {ECO:0000313|EMBL:AKQ06950.1} KW=Complete proteome; Reference proteome OX=1673889 OS=Mycobacterium phage Ovechkin. GN=PBI_OVECHKIN_48 OC=Viruses; dsDNA viruses, no RNA stage; Caudovirales; Siphoviridae.
Sequence
MTYTARPSGLWKALAELDARQMKEAAELDALREENARLRCRLQELGETA
Download sequence
Identical sequences A0A0A0RLR7 A0A0H4TF44 A0A0K2FNM9 B5U4P8 G1D1E1 W6AT84
gi|206599928|ref|YP_002241734.1| gi|589891281|ref|YP_009007521.1| B5U4P8_9CAUD YP_002241734.1.71717 YP_009007521.1.21387 YP_009202328.1.25657 YP_009208790.1.28149 YP_009211212.1.50132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]