SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H4WRV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H4WRV0
Domain Number 1 Region: 2-116
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000353
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0H4WRV0
Sequence length 120
Comment (tr|A0A0H4WRV0|A0A0H4WRV0_9DELT) Uncharacterized protein {ECO:0000313|EMBL:AKQ65509.1} KW=Complete proteome OX=1297742 OS=Myxococcus hansupus. GN=A176_002421 OC=Cystobacterineae; Myxococcaceae; Myxococcus.
Sequence
MGWNLDADLRAFYLHCDGAALFEPVPDADYRILPLAELRRARVAIFGRDEDAYGSPSLYA
LVDMQDTNYVVIDVASKASRYPLFDAFHETFPQADQIAPSFEDFLARALKSGGRSFWLGA
Download sequence
Identical sequences A0A0H4WRV0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]