SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H4XPR0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H4XPR0
Domain Number 1 Region: 9-138
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000101
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0H4XPR0
Sequence length 242
Comment (tr|A0A0H4XPR0|A0A0H4XPR0_9DELT) Uncharacterized protein {ECO:0000313|EMBL:AKQ70357.1} KW=Complete proteome OX=1297742 OS=Myxococcus hansupus. GN=A176_007269 OC=Cystobacterineae; Myxococcaceae; Myxococcus.
Sequence
MVQAITQYHPTFANEVRGCTPSEVARIEAAVGRPLPASYVDFLRTMGRSTGPLQLLQDSD
VFSFEPVVAYHDNKDIPKAPARYLLFGLAEDDPYFDIYLDSGSQEPQVIRFPTPESAKDF
PAAIQQCDWLAPSLSEFIFAKAFFQFHVSQFPQRTSLAESPEARSRLDQEQAAAPLTKLG
FTRHPLSSDAVAYYERPTSLVVASKSHPSDAPLLFTVAAYDRKELLKIEDVLAQQLQLIT
PG
Download sequence
Identical sequences A0A0H4XPR0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]