SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H5AFT3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H5AFT3
Domain Number 1 Region: 17-137
Classification Level Classification E-value
Superfamily PapD-like 1.91e-30
Family Pilus chaperone 0.00095
Further Details:      
 
Domain Number 2 Region: 144-231
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 0.000000000144
Family Periplasmic chaperone C-domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0H5AFT3
Sequence length 234
Comment (tr|A0A0H5AFT3|A0A0H5AFT3_9PSED) Uncharacterized protein {ECO:0000313|EMBL:AKS09996.1} KW=Complete proteome OX=200450 OS=Pseudomonas trivialis. GN=AA957_29095 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSRLGVSGLLMCLVAGSALADIVIDRTRLIYLASEREVSVTLTNFADSPRLVQAWIDAGD
AQVQPEYSDVPFSLVPPILRIEPGKGQAMRIILQPPLEMATETVYWLNVLSIRPNPEAQA
SNTLQWAFRTRIKLFLRTRPPPDSDQPVLRWRLTRTAPALLEVHNPSAYHVTVSRILLIV
DGTQYRSDAPPMVAPNSGLTLPLDGALINPWGRATLHFSTLDDHGITHHHEQRL
Download sequence
Identical sequences A0A0H5AFT3
WP_049713276.1.16533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]