SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H5BH61 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H5BH61
Domain Number 1 Region: 19-104
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 1.19e-28
Family TATA-box binding protein (TBP), C-terminal domain 0.0000631
Further Details:      
 
Domain Number 2 Region: 108-174
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 1.57e-17
Family TATA-box binding protein (TBP), C-terminal domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0H5BH61
Sequence length 180
Comment (tr|A0A0H5BH61|A0A0H5BH61_9EUKA) TATA binding protein of transcription factor IID {ECO:0000313|EMBL:BAS01571.1} OX=74820 OS=Lotharella vacuolata. GN=tfIId OC=Eukaryota; Rhizaria; Cercozoa; Chlorarachniophyceae; Lotharella.
Sequence
MKKKIVSKKSKDPKTILNIKPKITNMVCTVDLDCMLDLRKIALKTKNSEYNPKRFHALII
RLRNPKTTAMVFKTGKLVCTGAKDEQTSRQAIKKFVQLIKNSGFCSIKIKNYSIRNLVAV
CNFNSPIRLETINYTYRESCMYEPEVFPGLIFRPENSKVVAMIFMTGRVVLTGFCFLKKV
Download sequence
Identical sequences A0A0H5BH61

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]