SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H5C491 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H5C491
Domain Number 1 Region: 27-177
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000000366
Family SMI1/KNR4-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0H5C491
Sequence length 219
Comment (tr|A0A0H5C491|A0A0H5C491_CYBJA) Uncharacterized protein {ECO:0000313|EMBL:CEP22925.1} KW=Complete proteome; Reference proteome OX=4903 OS=Cyberlindnera jadinii (Torula yeast) (Pichia jadinii). GN=BN1211_3384 OC=Saccharomycetes; Saccharomycetales; Phaffomycetaceae; Cyberlindnera.
Sequence
MTTDGIETIVNRLREVSKNNFPHIPPNILKEGIPVDKVTQFERERSIHLPEDVRQFLQLL
NGEGVHDDGTQSGFLMGLSLLSLADIEREMNIWQEVMDDNPVFAEWHSVSYPPDCIQEVY
CDPKHWIGLAVDGCGNSIGIDLKPGPKGRVGQVIVFGRDYDDKCVIANNWTQFLDECVSF
IERGESFKVDGNFYELDDSGTYIDEVYEKCMTDVRKSIP
Download sequence
Identical sequences A0A0H5C491 A0A1E4RUD4
XP_020067714.1.24254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]