SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0H5M074 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0H5M074
Domain Number 1 Region: 4-132
Classification Level Classification E-value
Superfamily MOSC N-terminal domain-like 2.09e-28
Family MOSC N-terminal domain-like 0.018
Further Details:      
 
Domain Number 2 Region: 283-366
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.28e-19
Family 2Fe-2S ferredoxin-related 0.013
Further Details:      
 
Domain Number 3 Region: 3-50,147-263
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 1.36e-16
Family MOSC (MOCO sulphurase C-terminal) domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0H5M074
Sequence length 369
Comment (tr|A0A0H5M074|A0A0H5M074_YERIN) Putative iron-sulfur binding protein {ECO:0000313|EMBL:CRY56695.1} KW=Complete proteome OX=631 OS=Yersinia intermedia. GN=ERS008476_03740 OC=Yersiniaceae; Yersinia.
Sequence
MITLSRLYVHPVKSMRGLQLSHAQVSSSGLAFDRVFMITEPDGTFMTARQNPKMVMFTPA
LMSDGLYLTAPDGESASIRFNDFLANAEPTEVWGNHFTALIAPPAINSWLSGYFQREVQL
RWLGPELTRRVKPLPEIPLSFADGFPYLLINEASFKALQQRCPSSIKLEQFRPNLVVTGA
DAFAEDNWKVIRVGDITFDLVKPCSRCVLTTVSVERGRKHPSGEPLRTLQTFRTAENGDI
DFGQNMVARNSGIIRVGDEVEILSTKPPRPYSEGIVVESLAAPEDKSKVVSIEYNGIRFN
GNNQQVLLEQLEQQNIRIPYSCRAGICGCCRITLVDGDVAPLKQSAIGNDGTILCCSCIP
KGNITLSGK
Download sequence
Identical sequences A0A0H5M074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]