SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0I2EB68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0I2EB68
Domain Number 1 Region: 8-85
Classification Level Classification E-value
Superfamily Ornithine decarboxylase C-terminal domain 1.57e-29
Family Ornithine decarboxylase C-terminal domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0I2EB68
Sequence length 91
Comment (tr|A0A0I2EB68|A0A0I2EB68_SHISO) Lysine decarboxylase CadA {ECO:0000313|EMBL:CST21752.1} KW=Complete proteome OX=624 OS=Shigella sonnei. GN=ERS009867_03962 OC=Enterobacteriaceae; Shigella.
Sequence
MPVHLSMTEEVYLDEMVGRINANMILPYPPGVPLVMPGEMITEESRPVLEFLQMLCEIGA
HYPGFETDIHGAYRQADGRYTVKVLKEESKK
Download sequence
Identical sequences A0A0I2EB68

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]