SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0I9N967 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0I9N967
Domain Number - Region: 43-80
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0242
Family Extracellular domain of cell surface receptors 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0I9N967
Sequence length 137
Comment (tr|A0A0I9N967|A0A0I9N967_BRUMA) Bm453 {ECO:0000313|EMBL:CTP81218.1} OX=6279 OS=Brugia malayi (Filarial nematode worm). GN=Bm453 OC=Spiruromorpha; Filarioidea; Onchocercidae; Brugia.
Sequence
MIKDYNVVILDNRHIFQIKGCDADDIQDDMLIYVPSLTGKPWENIMEACLASECRVHNDL
LGGKGESYLCGCDTDYCNEKSFQDTFPRLKNNNNNNNTASKASMLNDNLFRFISGSGIII
RVFLLNNYSFSPFEKII
Download sequence
Identical sequences A0A0I9N967
Bm453 XP_001893367.1.25112 Bm1_09470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]