SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0I9SAZ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0I9SAZ8
Domain Number - Region: 59-111
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00549
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0I9SAZ8
Sequence length 115
Comment (tr|A0A0I9SAZ8|A0A0I9SAZ8_BACFG) Uncharacterized protein {ECO:0000313|EMBL:KFX75350.1} KW=Complete proteome OX=817 OS=Bacteroides fragilis. GN=EE52_0207825 OC=Bacteroides.
Sequence
MKKLKRPASQSEAMRLKWKRHIVFEKGYTESCAEWMAERLETLLDHMQYGHAAVAYRKQN
GSFQLVKATLIYYEAKFHKKYNPTKVEGAVVYWNVDEQRWTTFQVENFMEWRPVV
Download sequence
Identical sequences A0A0I9SAZ8 K1G9F9
WP_005807522.1.22866 WP_005807522.1.79765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]