SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0I9W437 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0I9W437
Domain Number 1 Region: 11-43
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000222
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0I9W437
Sequence length 133
Comment (tr|A0A0I9W437|A0A0I9W437_9MICO) Uncharacterized protein {ECO:0000313|EMBL:KLO63395.1} KW=Complete proteome; Reference proteome OX=1641401 OS=Dermacoccus sp. PE3. GN=AA983_00655 OC=Bacteria; Actinobacteria; Micrococcales; Dermacoccaceae; Dermacoccus.
Sequence
MSYSEYFASDQLDTPATEDEIAHAEEALGVTFPDDLRAFWLTSATLNGQVLTADGGPGPY
LRVLHPSSVTKVGEACVFGRGEDWDFGVVPGHPTRWVDVERGTGEELSELGATFVGFLES
LRVEFETENNLLD
Download sequence
Identical sequences A0A0I9W437
WP_047310332.1.56783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]