SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0I9YDB8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0I9YDB8
Domain Number - Region: 121-154
Classification Level Classification E-value
Superfamily Stathmin 0.0248
Family Stathmin 0.0097
Further Details:      
 
Domain Number - Region: 74-180
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0994
Family BAR domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0I9YDB8
Sequence length 185
Comment (tr|A0A0I9YDB8|A0A0I9YDB8_GIBFU) Uncharacterized protein {ECO:0000313|EMBL:KLO93245.1} KW=Complete proteome OX=5127 OS=fujikuroi). GN=FFC1_14612 OC=Fusarium; Fusarium fujikuroi species complex.
Sequence
MSSHYTPAGYSMPLPVPSKGSQYPTYSQYSVSPPECDDSVSSASGIPSYSNGGYSATSSG
YQYSGGYGEYESTRSASGVDFQEYMQDRFANSFDPIPLDRSMAMQAQTSGKMNAKHRELM
ELQKKAQARLAKTRERFQEGMRDAHEVRSDLEWTQKKVGSLKTKASRKHGKEYSKARARF
PSPEN
Download sequence
Identical sequences A0A0I9YDB8 A0A1L7UC70 A0A1L7VM63 A0A2K0WGG5 S0E9S0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]