SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0I9YHZ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0I9YHZ2
Domain Number 1 Region: 346-395
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000706
Family SMI1/KNR4-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0I9YHZ2
Sequence length 554
Comment (tr|A0A0I9YHZ2|A0A0I9YHZ2_GIBFU) Uncharacterized protein {ECO:0000313|EMBL:KLO94953.1} KW=Complete proteome OX=5127 OS=fujikuroi). GN=LW93_3646 OC=Fusarium; Fusarium fujikuroi species complex.
Sequence
MATSRPKDIEPENLRFEFLLRHVDDEPSIADARSLTEAIRKCIQTAVNFAVVGEVGGSTR
LLETLTSRGHDPFQYSDSEYPFLKPCMFFAWEATSSWPSWVPEEERTEEKLQELEIEGSK
NWLERFSQEWEVTEETAEKALDMAYNGLTTNLPDYNGTLAGQVIQAETMTANGDFSYSAS
PNGPMAIRYMKIAMWWRQGIFPYPFVQLYRTAGLMIALDIYLRLGKDEKARELFMKVCDR
FHTEEQVEQLSCSRAAWKQILAVPERPLLDFLNIHAAKLRPAVTRACQMAENRLQNGPRR
RYAGQSIEKLVHMISENTFKNCPYDRLDAYRPYGNLRNRPKDTDGLLRRGCTVSGIRALE
ERLGVTLPEDYKEFLSITNGLDSMWDGQNLVDYLAGAQEVNWQEIDFLEGNELPLLNDGE
PLAWTKNILEWPTIAKPRCICLSGDINHEERAGHFFLIGQDLLQPAKDYFFKTYEERNDT
QRRELDRLVQETYGSMETFRNLEWALISWTAWDFTVYPYNGLRDFLEQMAEASLRQERPW
LNMFEPRFRKMANA
Download sequence
Identical sequences A0A0I9YHZ2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]