SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J0V6F0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J0V6F0
Domain Number 1 Region: 2-217
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.48e-81
Family Phosphate binding protein-like 0.00000294
Further Details:      
 
Domain Number 2 Region: 219-307
Classification Level Classification E-value
Superfamily Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 2.62e-24
Family Porphobilinogen deaminase (hydroxymethylbilane synthase), C-terminal domain 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0J0V6F0
Sequence length 310
Comment (tr|A0A0J0V6F0|A0A0J0V6F0_9BACI) Pre-uroporphyrinogen synthase {ECO:0000256|HAMAP-Rule:MF_00260} KW=Complete proteome OX=1659191 OS=Geobacillus sp. T6. GN=ABH20_08375 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Geobacillus.
Sequence
MRNIVVGSRRSKLALTQTKWVINELKQLGAPFTFEVKEIITKGDRVLDVTLSKVGGKGLF
VKEIEHELLAGGIDMAVHSMKDMPAVLPEGLVIGAVPRREDARDVLVSKGNRMLSDLPPG
SVIGTSSLRRSAQLLAYRPDLTIKWIRGNIDTRLAKLESEEYDAIVLAAAGLARMGWGDD
VISDYLPFDVCVPAVGQGALAVECREDDDELRQWLSRLNDEQTERAVRAERAFLQQMEGG
CQVPIAGYAEVEGGAVRLTALVASPDGKEKYKEMVTGADPEAVGRQAAAVLIEQGAKALI
ERVKRELSQS
Download sequence
Identical sequences A0A0J0V6F0 A0A226QA85
WP_025949390.1.57889 WP_025949390.1.65208 WP_025949390.1.86012 WP_025949390.1.9165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]