SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J0XJC8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J0XJC8
Domain Number 1 Region: 16-98
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.0000288
Family C-terminal domain of PLC-beta 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J0XJC8
Sequence length 147
Comment (tr|A0A0J0XJC8|A0A0J0XJC8_9TREE) Uncharacterized protein {ECO:0000313|EMBL:KLT41183.1} KW=Complete proteome; Reference proteome OX=879819 OS=Cutaneotrichosporon oleaginosum. GN=CC85DRAFT_276508 OC=Cutaneotrichosporon.
Sequence
MEDRDEWSFTRCLPALTELLRDDEFVKELRKMKKDQEALERRLWARMEKIKAEQMAKRAA
DNQIAKITRKPVPAEKVAQWERELQAALSDLFVRQVLPSFDGLEARQAARLTELGVPGLG
GGKRGEDAKARQVRVRRIMGVLEGALD
Download sequence
Identical sequences A0A0J0XJC8
XP_018277674.1.77916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]