SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J0XKW0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J0XKW0
Domain Number 1 Region: 15-88
Classification Level Classification E-value
Superfamily Cell wall binding repeat 4.84e-18
Family Cell wall binding repeat 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0J0XKW0
Sequence length 89
Comment (tr|A0A0J0XKW0|A0A0J0XKW0_PAESO) Toxin A {ECO:0000313|EMBL:KLR48638.1} KW=Complete proteome OX=1172204 OS=Paeniclostridium sordellii 8483. GN=WS9_42417 OC=Peptostreptococcaceae; Paeniclostridium.
Sequence
DANNIEGQAILYQNEFLTLNGKKYYFGSDSKAVTGWRIINNKKYYFNPNNAIAAIHLCTI
NNDKYYFSYDGILQNGYITIERNNFYFDA
Download sequence
Identical sequences A0A0J0XKW0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]