SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J0XSA8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J0XSA8
Domain Number 1 Region: 1-157
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 1.31e-57
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.00000603
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J0XSA8
Sequence length 158
Comment (tr|A0A0J0XSA8|A0A0J0XSA8_PAESO) 5-(carboxyamino)imidazole ribonucleotide mutase {ECO:0000256|HAMAP-Rule:MF_01929} KW=Complete proteome OX=1172204 OS=Paeniclostridium sordellii 8483. GN=WS9_30190 OC=Peptostreptococcaceae; Paeniclostridium.
Sequence
MKVAVVMGSKSDYPKLEKGIELLEKFKIEVSVRVLSAHRTPNQLMNFLKEIENDTDVIIG
AAGKAAHLPGVIASHTLIPVIGLPIKSSTMDGLDSLLSIVQMPQGIPVATVTIDSGVNAA
LMATQIMSIKYPVIKEQLKNYRKEMELKVLEDDQNLRG
Download sequence
Identical sequences A0A0A1S4H4 A0A0J0XSA8 T0E9E7
WP_021121802.1.15023 WP_021121802.1.1823 WP_021121802.1.25578 WP_021121802.1.51000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]