SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J0XYW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J0XYW6
Domain Number 1 Region: 89-163,190-233
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000432
Family SMI1/KNR4-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J0XYW6
Sequence length 755
Comment (tr|A0A0J0XYW6|A0A0J0XYW6_9TREE) Uncharacterized protein {ECO:0000313|EMBL:KLT46247.1} KW=Complete proteome; Reference proteome OX=879819 OS=Cutaneotrichosporon oleaginosum. GN=CC85DRAFT_298937 OC=Cutaneotrichosporon.
Sequence
MSFFQSLSSMFGRAQPRPNSQDSFQLPTTQYTQGLNPGSGALDATPGPSRRTSYQPQSGQ
YPPKTAQQHPPLSHTFHRLRNALVDDFPELLDSLNPPASQATIASIEQELGGPLPPAVRE
YFSVVDGQDLESNGAGIFYGLYLLPLDEVMREWHFWRQAEADPSTGSNPAVLATMASIPP
QWVKSLYACKGWLPLLSDRSGNYVGVDLDPGAQGQWGQAIIFGRDFDRKCVLWRGEGESG
WAKWVSSVVEEFESHEGWEVDKTSDDEEEIGYSSYSGANVYGDGGHTMRLTGEYKGWNVL
EAWWDKSVRKWEGLGLGMDVTEIERGLAEARRIHEESSKGKGKESARNSVEVAGIRANQR
TADSEIPVLAAVAASPEHSPAIPQGGEDSQTLLPPTSPEVSAIPRILHPKGTPTRSTMTS
HPLESPTSGTTSPSTSSTAATDFLVPPSHRASSSRQQQRRSRPPPPAAVLDLPTRADVQA
AQAVANAEARGMRGGWVMNLDATSNVANRRRTHNISPSLDAEMVDIDLEGGRMEAFGTPP
MSAVEEEKQQLEDKLSMAPIEQRRDTRSPSLLGMSRTPSPLAQQTSPPPAQQTSRPGSTA
SPPQPNRQGSGSQRWSSSSSSEAHRSLVSPIATPPLRAPSPSALPPNLAAVAEAAIRRPE
PVVGYRSVSPVPEDWHEREVIRGANDRRRSSVTPTGVMTPSRGDSMMSADSEGALLEKDE
RGTASPPNGHGHVVTPTAATFKRKDIAEALEEVSL
Download sequence
Identical sequences A0A0J0XYW6
XP_018282738.1.77916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]