SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J0YPB1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J0YPB1
Domain Number 1 Region: 18-138
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 8.5e-29
Family SMI1/KNR4-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0J0YPB1
Sequence length 140
Comment (tr|A0A0J0YPB1|A0A0J0YPB1_9NEIS) Uncharacterized protein {ECO:0000313|EMBL:KLT71972.1} KW=Complete proteome; Reference proteome OX=1470200 OS=Neisseria arctica. GN=PL75_10765 OC=Neisseriaceae; Neisseria.
Sequence
MKNEELKSTILDLINRAEGNRIQIPLPDDNLIAEYEKIIGLHFDEEYKFFLKNASNILYG
FIEPLVITADQSSRSELSHAISEAKLLGVPSNWLPICEDNGDYYCLTEDKSIHLWTSNGL
TEECWPNLSSWINQVWINNG
Download sequence
Identical sequences A0A0J0YPB1
WP_047761930.1.85082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]