SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J1C0W2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J1C0W2
Domain Number 1 Region: 2-81
Classification Level Classification E-value
Superfamily MgtE membrane domain-like 0.0000000000000536
Family MgtE membrane domain-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0J1C0W2
Sequence length 81
Comment (tr|A0A0J1C0W2|A0A0J1C0W2_9NEIS) Uncharacterized protein {ECO:0000313|EMBL:KLT71893.1} KW=Complete proteome; Reference proteome OX=1470200 OS=Neisseria arctica. GN=PL75_11195 OC=Neisseriaceae; Neisseria.
Sequence
ITMIVRAMAMGQLSGMRAGRLVRKEVGVALVNGLIWGGVMGVVAWLLYDGPGIGFVMVSA
VTLNLLLAATVCVLIPVLMDK
Download sequence
Identical sequences A0A0J1C0W2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]