SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J1CGJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J1CGJ0
Domain Number 1 Region: 142-254
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.96e-26
Family AadK C-terminal domain-like 0.0064
Further Details:      
 
Domain Number 2 Region: 1-136
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.54e-25
Family AadK N-terminal domain-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J1CGJ0
Sequence length 267
Comment (tr|A0A0J1CGJ0|A0A0J1CGJ0_PROMI) Aminoglycoside adenylyltransferase {ECO:0000313|EMBL:KLU19679.1} KW=Complete proteome OX=584 OS=Proteus mirabilis. GN=ABE79_02985 OC=Morganellaceae; Proteus.
Sequence
MEPTTRLIDRTLSFALLDPRIEAVILTGSLGRNKKIDSYSDIDIELIGYGATELAKNQHW
LSQFGDSLVNLQLECEDPKGKLWPIYLHVLAQGRKMDIMMAEPERIFSMKTEGLSPVYQR
GYQILLDKTGLCDGLPEISTITPPTLTKEQAYDNAQEFWFEASQVAIAILRHEFWFANYR
INDMREWLIELLEQVALSTSTQDVWYQGKNLKEWLPKFYSLRSLESTLAMSTPYESAAAL
SVMMAFFLDASKRLNHPIDTAIKTQEL
Download sequence
Identical sequences A0A0J1CGJ0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]