SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J1CU08 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J1CU08
Domain Number 1 Region: 1-135
Classification Level Classification E-value
Superfamily RPA2825-like 6.93e-49
Family RPA2825-like 0.0000282
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J1CU08
Sequence length 135
Comment (tr|A0A0J1CU08|A0A0J1CU08_9BURK) Uncharacterized protein {ECO:0000313|EMBL:KLU23821.1} KW=Complete proteome; Reference proteome OX=908627 OS=Caballeronia mineralivorans PML1(12). GN=EOS_24090 OC=Burkholderiaceae; Caballeronia.
Sequence
MSIFGTILSKIFPSSHPANTAPADPAAPAATDTTDATSAPEASAPAAAPEPVDVEAVLAD
MQANTSEQLNWRTSIVDLMKLLGLDSSLSARKELAGELHYTGDTNDSASMNIWLHKAVME
QLAANGGKVPDSLKN
Download sequence
Identical sequences A0A0J1CU08
WP_047849308.1.28875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]