SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J1EUQ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J1EUQ9
Domain Number 1 Region: 1-148
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 7.46e-60
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.00000447
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0J1EUQ9
Sequence length 161
Comment (tr|A0A0J1EUQ9|A0A0J1EUQ9_9MICC) 5-(carboxyamino)imidazole ribonucleotide mutase {ECO:0000256|HAMAP-Rule:MF_01929} KW=Complete proteome; Reference proteome OX=1660349 OS=Kocuria sp. SM24M-10. GN=ABL57_13985 OC=Bacteria; Actinobacteria; Micrococcales; Micrococcaceae; Kocuria.
Sequence
MGSDSDWPVMEAAATALDEFGIAYEVDVVSAHRMPAEMIDYGRRAHDRGLRVLIAGAGGA
AHLPGMLASVTPLPVIGVPVPLRTLDGMDSLLSIVQMPAGVPVATVSIGGARNAGLLAAR
ILAAGADDRAAQLREQLVHFASELRQTAQDKGAALRSRLGA
Download sequence
Identical sequences A0A0J1EUQ9 A0A1Q9S229
WP_047804116.1.41706 WP_047804116.1.87979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]