SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J1I1V1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J1I1V1
Domain Number 1 Region: 137-280
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.33e-55
Family AadK C-terminal domain-like 0.0000633
Further Details:      
 
Domain Number 2 Region: 1-134
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.93e-47
Family AadK N-terminal domain-like 0.0000465
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0J1I1V1
Sequence length 290
Comment (tr|A0A0J1I1V1|A0A0J1I1V1_BACAN) Aminoglycoside adenylyltransferase {ECO:0000313|EMBL:KLV19833.1} KW=Complete proteome OX=1392 OS=Bacillus anthracis. GN=ABW01_07720 OC=Bacillus cereus group.
Sequence
MRTEKEMLDLIINTAKEDERIRAVIMNGSRVNPNVKKDCFQDYDAIYVVKDICSFTSNHN
WIHRFGAIMMVQMPEEMSLVPPDRDGKFPYLMQFMDGNRIDLTLVPVDLINNFVRQDSLS
KLLLDKDNCMEEFPPASDKDYLIKKPTEKEFLDCCNEFWWCSTNVAKGLWREELSYVKGM
FDGPVRDMLIVMLEWHIGMKTDFIVNAGKFGKHFEKYIEKDMWVQFKRTFSNAEYENIWE
SFFVMGNLFREVANEIANAYGYPYPQGDDDRVTSYLKHVKALPKDSTSIY
Download sequence
Identical sequences A0A0J1I1V1
WP_047956515.1.17424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]