SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J1IHW9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J1IHW9
Domain Number 1 Region: 20-175
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.11e-20
Family SMI1/KNR4-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J1IHW9
Sequence length 216
Comment (tr|A0A0J1IHW9|A0A0J1IHW9_BACCI) 1,3-beta-glucan synthase regulator {ECO:0000313|EMBL:KLV25501.1} KW=Complete proteome; Reference proteome OX=1397 OS=Bacillus circulans. GN=ABW02_16080 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MDYELIRYRIEAITSKIKEIGGEVQEVIIDEPASLEQIIKTEEQLGRKLPESFKKVLNEF
SSNFSLRWFLPDNMEQPKEFREIFSGTPHWSLELLSQCEEDRMGWIENVFSDPEDEYDVV
WHNKLAFSEVGNGDYLAFDMSNTEDAPIVYLSHDNGEGHGYILANNFIEFLNNWSRIGFV
GCEDWQWLPFTTSPGSGIVADGEEAGLFRTWLGLDI
Download sequence
Identical sequences A0A0J1IHW9
WP_047943305.1.65649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]