SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J1KJX2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J1KJX2
Domain Number 1 Region: 20-147
Classification Level Classification E-value
Superfamily PapD-like 1.57e-41
Family Pilus chaperone 0.00045
Further Details:      
 
Domain Number 2 Region: 149-237
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 1.96e-18
Family Periplasmic chaperone C-domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J1KJX2
Sequence length 240
Comment (tr|A0A0J1KJX2|A0A0J1KJX2_9ENTR) Uncharacterized protein {ECO:0000313|EMBL:KLV50337.1} KW=Complete proteome OX=1686377 OS=Citrobacter sp. MGH100. GN=SK32_01023 OC=Enterobacteriaceae; Citrobacter; Citrobacter freundii complex.
Sequence
MNLQNTFRIIILSTTISFSYSSVASIVINATRVIYPSDAKEALIKMVNQGQQPLLVQSWL
DDGHEDVDPQTLNVPFIASPPVSRVDPKQGLTVRLNWDGQPLPTDRESVYWFNALEIPGK
NKDAAKSNQLQIALKTRIKVFYRPASLPGSADDAIQHLKWSLANQGKQVWATAKNDSPYF
VSLVGANITSGGKKYKIEPDMVAPFSSASYEVKTLTTPRLESVSWTAVNDYGANVDVTDK
Download sequence
Identical sequences A0A0J1KJX2 A0A243UDB0
WP_048211581.1.41089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]