SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J1KLM3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J1KLM3
Domain Number 1 Region: 12-139
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000719
Family SMI1/KNR4-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0J1KLM3
Sequence length 142
Comment (tr|A0A0J1KLM3|A0A0J1KLM3_BACAN) SMI1/KNR4 family protein {ECO:0000313|EMBL:KLV17600.1} KW=Complete proteome OX=1392 OS=Bacillus anthracis. GN=ABW01_15105 OC=Bacillus cereus group.
Sequence
MHALPNCLEEVLEEDIYKRADKDQVNEVINRLGVEVSNTFREFYYRFAGPFWEEHVPYEL
LDIIDEENNIEYYTIIARKEHGFPNKYLVLTEMTANAALVLDSVTDKVYSVNFEGGDELL
LNGELKESWPTFYMFLKEYFKC
Download sequence
Identical sequences A0A0J1KLM3 A0A0U0G7M9 A0A1Y6AK20 B3Z488 C3G531
WP_000543090.1.17424 WP_000543090.1.34158 WP_000543090.1.45385 WP_000543090.1.56580 WP_000543090.1.66331 WP_000543090.1.90155 WP_000543090.1.94373 WP_000543090.1.97149 WP_000543090.1.99454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]