SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J1VUR4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J1VUR4
Domain Number 1 Region: 14-149
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000000523
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0J1VUR4
Sequence length 177
Comment (tr|A0A0J1VUR4|A0A0J1VUR4_9ENTR) Uncharacterized protein {ECO:0000313|EMBL:KLW90912.1} KW=Complete proteome OX=1594172 OS=Enterobacter sp. BIDMC92. GN=SP99_01114 OC=Enterobacteriaceae; Enterobacter.
Sequence
MLLTINEIEVKLHEKFSPFDGEMDDLILKKRMAPVNNIKQSEERLGVDFPKDFIEIVNNY
DIDNFSLGNISFGHDDDYLEKVVRINSDEFNHWWIGEHRPDGVICIAISDPYTILLNTHD
DKVYAITSEQTMDGWESIADTFELFIRGVGSHFLKACPLTEIINSTGTNDISFWNSI
Download sequence
Identical sequences A0A0J1VUR4
WP_047957956.1.27591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]