SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J2EUJ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0J2EUJ5
Domain Number - Region: 348-595
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000882
Family Ankyrin repeat 0.01
Further Details:      
 
Domain Number - Region: 116-201,484-558
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00102
Family Pseudo ankyrin repeat 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J2EUJ5
Sequence length 719
Comment (tr|A0A0J2EUJ5|A0A0J2EUJ5_ECOLX) Toxin {ECO:0000313|EMBL:ARR58441.1} KW=Complete proteome OX=562 OS=Escherichia coli. GN=BMT94_11750 OC=Enterobacteriaceae; Escherichia.
Sequence
MVDNVTVGSVCAQSPSFMPDLDGGKNKTQLIVDDIVAYLKNPSVYSLEKEGPLNHFVNYC
SEVELGFYSDGAYSILVSRSKQQPEGMILTVSDADAINIVHISVSPALIKFLDDIFTCLH
TYPDDESFTKEQIKANSKYDVINYNCKIFFNEKPENEIVCRHLSLQYCIDSMNEHTGKVP
LKAYYSSPEDIQKHIPFELEQQFDNLQKNPPPGTCVVACDKFGEALSVFFHRMEKEKLTH
MAAIVQSQTHAMAVRLRIKKTPAGETEYVVSFYDPNATNTAVRYKANNCDSFGSLRSFMN
IKQAQKKWVMTEICSDCVGITPYLPREQAHLLSGINNELQPPLSPLALHLLIQMGMHENI
VLFFDKFKNSQEMTASKVLAAKSITGTYGLYVLWYQNSIDVFNEFIINLKELTRKYNFSH
SDLENILLAKDYLGVSWIPKALRNNQNKIVKEWLLAIDDFEKEFGVNKNEILRSVGKEID
SIYDLNSAIRTNNYNVVNILLANIKAKMFKNEINKEDILKLMAAREWTGESDKWTKASGL
YSAIVKGHTEIVAAWMETAEVIASHYENDKDVVRELLSLSRNNAACSLHIASFKKMSKEV
IDVYLNAAIRLALQHGFSFDEIVEQFTRDFDGKSFSHVVNNGDDIHMGLWLKIFKIVVGE
NENYLKDVMMQLEEKNNEGKSVISLANGNPVLKELFWKAVDEFNFPQEELNRLKQYRSL
Download sequence
Identical sequences A0A0J2EUJ5 L2X5W6 S0V437 T5UEK8
WP_001521714.1.101769 WP_001521714.1.10744 WP_001521714.1.11956 WP_001521714.1.13469 WP_001521714.1.13473 WP_001521714.1.14616 WP_001521714.1.15949 WP_001521714.1.16667 WP_001521714.1.18472 WP_001521714.1.18655 WP_001521714.1.18794 WP_001521714.1.19861 WP_001521714.1.22602 WP_001521714.1.24758 WP_001521714.1.25193 WP_001521714.1.25272 WP_001521714.1.2665 WP_001521714.1.2782 WP_001521714.1.30762 WP_001521714.1.30987 WP_001521714.1.31083 WP_001521714.1.32558 WP_001521714.1.32676 WP_001521714.1.33428 WP_001521714.1.34966 WP_001521714.1.35012 WP_001521714.1.35744 WP_001521714.1.37360 WP_001521714.1.38234 WP_001521714.1.39196 WP_001521714.1.39254 WP_001521714.1.42808 WP_001521714.1.44394 WP_001521714.1.4463 WP_001521714.1.44642 WP_001521714.1.4811 WP_001521714.1.52568 WP_001521714.1.52771 WP_001521714.1.64330 WP_001521714.1.66751 WP_001521714.1.6810 WP_001521714.1.72352 WP_001521714.1.74631 WP_001521714.1.75839 WP_001521714.1.7680 WP_001521714.1.78131 WP_001521714.1.78453 WP_001521714.1.81888 WP_001521714.1.85320 WP_001521714.1.88717 WP_001521714.1.91010 WP_001521714.1.91213 WP_001521714.1.92473 WP_001521714.1.95080 WP_001521714.1.95846 WP_001521714.1.98626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]