SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J3YQP5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0J3YQP5
Domain Number - Region: 11-47
Classification Level Classification E-value
Superfamily Mitotic arrest deficient-like 1, Mad1 0.0929
Family Mitotic arrest deficient-like 1, Mad1 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J3YQP5
Sequence length 152
Comment (tr|A0A0J3YQP5|A0A0J3YQP5_ECOLX) Uncharacterized protein {ECO:0000313|EMBL:KME68490.1} KW=Complete proteome OX=562 OS=Escherichia coli. GN=SM09_03019 OC=Enterobacteriaceae; Escherichia.
Sequence
MLSKVNRLIRRTAQSLAACEASLQKLNAEKEKLAEKERLYDMQLKNLQSLLDMKELLGEV
VFRQDIFYSLRKVAVIQQQIAEINLEKQKIAERRKILNKEIVQQQAQRKHRWLKGEKYDR
LKKRIKKQLLNQMLYQDELEQEEKYNGRSQEN
Download sequence
Identical sequences A0A0J3YQP5 L2XET0 S0VTX1 T5U261 V2TFH0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]