SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J5H025 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J5H025
Domain Number 1 Region: 99-228
Classification Level Classification E-value
Superfamily Cyclophilin-like 4.55e-46
Family PH0987 C-terminal domain-like 0.00000534
Further Details:      
 
Domain Number 2 Region: 12-102
Classification Level Classification E-value
Superfamily PH0987 N-terminal domain-like 8.76e-19
Family PH0987 N-terminal domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J5H025
Sequence length 252
Comment (tr|A0A0J5H025|A0A0J5H025_9BACI) Allophanate hydrolase {ECO:0000313|EMBL:KMJ60399.1} KW=Complete proteome; Reference proteome OX=1665556 OS=Bacillus sp. LL01. GN=AB685_06210 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MIGGEAKVKTHFFPLGDTGVQVQFGSDISEETNQQIRIFADYLKKHPVDGIVEWVPAYTT
LTIFYRPDKILYKDLCNELETIIEALQGADEGSTSIVYEIPVLYGGEAGPDLSEVASHNG
LTEEEVISIHSSQAYLIYMMGFVPGFPYLGGMPKQIATPRRENPRAKIEAGSVGIAGEQT
GVYPLETPGGWQIIGRTPLKLYDAAKEDPILLSAGHYLRFVSVDHKEFEEIEEAISLGEY
KVKSYEKGGRKR
Download sequence
Identical sequences A0A0J5H025
WP_047969596.1.18761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]