SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J5JTY4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J5JTY4
Domain Number 1 Region: 4-143
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.12e-22
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0J5JTY4
Sequence length 146
Comment (tr|A0A0J5JTY4|A0A0J5JTY4_9BACI) Uncharacterized protein {ECO:0000313|EMBL:KMJ59120.1} KW=Complete proteome; Reference proteome OX=1665556 OS=Bacillus sp. LL01. GN=AB685_08645 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MVKIIDSHKPLSVKEIEQFENTHNVKFTELYRKFLLDNNGGYAVPNVFNVSDDQGESVLN
AIYGIGDMYDSLEDFIDIYEGRLPEGFIPIADDSNGNVICLGTDKKYYEKLYFWDHEKEA
EDMSNMYFLANNIYEFLDSLYEDTDS
Download sequence
Identical sequences A0A0J5JTY4
WP_047970178.1.18761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]