SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J6AGS2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J6AGS2
Domain Number 1 Region: 21-71,106-175
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 4.05e-20
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J6AGS2
Sequence length 187
Comment (tr|A0A0J6AGS2|A0A0J6AGS2_PECCC) Molybdenum cofactor biosynthesis protein MoeA {ECO:0000313|EMBL:KML65240.1} KW=Complete proteome OX=1267544 OS=Pectobacterium carotovorum subsp. carotovorum UGC32. GN=G033_17100 OC=Pectobacteriaceae; Pectobacterium.
Sequence
MNEHWSVFETWLETHWPEGRKGLNLPATEQELEALEHALGTSLPEDYKACLRIHNGQDTY
SGGIFENAEFLSTHAVLEQWEIWQSLLSDGQFEGIQSSPEDGIKTDWWNVKWIPFTHNGG
GDHYCLDLDAAVGGQHGQIITMWHDMDEREKLSPSFANWFQNYVSDVIAGKYVYSDEYGG
LTPIDEL
Download sequence
Identical sequences A0A0J6AGS2 A0A2I1BGY9
WP_048262169.1.19434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]