SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J6BMY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J6BMY9
Domain Number 1 Region: 140-282
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 2.35e-54
Family AadK C-terminal domain-like 0.000000544
Further Details:      
 
Domain Number 2 Region: 3-134
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 6.54e-50
Family AadK N-terminal domain-like 0.00000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J6BMY9
Sequence length 286
Comment (tr|A0A0J6BMY9|A0A0J6BMY9_BREBE) Aminoglycoside adenylyltransferase {ECO:0000313|EMBL:KMM19941.1} KW=Complete proteome OX=1393 OS=Brevibacillus brevis (Bacillus brevis). GN=AB432_09055 OC=Brevibacillus.
Sequence
MALRTEQEMMSMLIDFARKDDRIRLVTLEGSRTNKNIPADPFQDYDISYFVTEMDSFKEN
DQWLDVFGNRIMMQKPEDMELFPSELGNWFSYLMLFEDGNKVDLTLIPLDETEPYFADSD
GLVEVLLDKDERIKHEVLPSDHQYWTRKPTAREFDDCCNEFWMVSTYVVKGLARKEILFA
IDHLNEIARPNLLRMMAWQIGCEKGFTFSVGKNYKFIDHHLPKEDWDSLLSSYRENSYAD
MWESLFTCYELFRKYSKAVAESLGYPYPAYDEAITKYAGNIYHSWK
Download sequence
Identical sequences A0A0J6BMY9
WP_048032523.1.83547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]