SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J6BXW4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J6BXW4
Domain Number 1 Region: 7-127
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000484
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0J6BXW4
Sequence length 132
Comment (tr|A0A0J6BXW4|A0A0J6BXW4_BREBE) Uncharacterized protein {ECO:0000313|EMBL:KMM23448.1} KW=Complete proteome OX=1393 OS=Brevibacillus brevis (Bacillus brevis). GN=AB432_01045 OC=Brevibacillus.
Sequence
MPTDSAAELEKLKSFELPEDYVSYFSQYNRAVLFRDLEFGSSLFTILDPHNVIEYWKGYS
IDHPYYPIAWSSHSLGCICVDQDRLDSGNGYLTWIESMDPDNPIDIDLTFTEWLDKLIEH
EGKEFWIPFHEE
Download sequence
Identical sequences A0A0J6BXW4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]