SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J6E0H2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J6E0H2
Domain Number 1 Region: 40-173
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 4.32e-16
Family SMI1/KNR4-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0J6E0H2
Sequence length 182
Comment (tr|A0A0J6E0H2|A0A0J6E0H2_9BACI) SMI1/KNR4 family protein {ECO:0000313|EMBL:ATH91551.1} KW=Complete proteome; Reference proteome OX=1664069 OS=Bacillus glycinifermentans. GN=AB447_216705 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MPLATFIDKTVNGLKSLLDHKGTIKLFGSEGDITESQVTFPNYGASADDIRSFESKYSIS
FPEDYRLFLEQHNGARIFDIISDGKNIGGGLRLSSLEEEMGYVELFEGVNGIPTGHLLEE
CHLMIDKDRLDRGDPNYLYLFEDGLEYKPLNLNFEIFLDRYIICQGEAFWEWTYRTAENY
YR
Download sequence
Identical sequences A0A0J6E0H2
WP_048355658.1.92492 WP_048355658.1.99318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]