SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J6F9P1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J6F9P1
Domain Number 1 Region: 9-134
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000000379
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0J6F9P1
Sequence length 137
Comment (tr|A0A0J6F9P1|A0A0J6F9P1_9BACT) 1,3-beta-glucan synthase regulator {ECO:0000313|EMBL:KMM31432.1} KW=Complete proteome OX=328812 OS=Parabacteroides goldsteinii. GN=ACM15_22535 OC=Parabacteroides.
Sequence
MELEFNNKSESITAKDIADVERKNKFIFPQEIKSFLLANNGGQPNKTIYTQNSQDYVVDF
FLPIKSTEFEDLTYSATITDLSDIIPNTVIPFAIDPFGNYFVFDKAEGKIYFLEMEEVAL
SLLASDFESFISSLKKE
Download sequence
Identical sequences A0A0F5IPD4 A0A0J6F9P1 D4V842 G5SRC6 K9EFL8
WP_005842523.1.102092 WP_005842523.1.41584 WP_005842523.1.53855 WP_005842523.1.74405 WP_005842523.1.82285 WP_005842523.1.82567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]