SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J6GB08 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J6GB08
Domain Number 1 Region: 37-261
Classification Level Classification E-value
Superfamily Chemotaxis phosphatase CheZ 1.24e-59
Family Chemotaxis phosphatase CheZ 0.0000364
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0J6GB08
Sequence length 262
Comment (tr|A0A0J6GB08|A0A0J6GB08_9PSED) Chemotaxis protein CheZ {ECO:0000256|PIRNR:PIRNR002884} KW=Complete proteome OX=882211 OS=Pseudomonas deceptionensis. GN=SAMN04489800_3986 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MEHQEATQGDFESTLKKHAHELVESLERGQFGDAVQLIHELNQTRDRGLYREVGKLTREL
HSAIVNFHIDPSMPQAEEVSQITDATERLAYVVKLTEAAANRTMDLVEHSTPLVNGMAQE
AKALSTDWGRFMRREVGAEEFRELARRVDSFLTRSETQNNTVSANLTDILLAQDYQDLTG
QVIKRVTQLVTEVESNLLKLVLMASQVDRFAGIEHDRDAMRAENKSQKSQTKGEGPQIHA
DTRNDVVSGQDDVDDLLSSLGF
Download sequence
Identical sequences A0A0J6GB08
WP_048360776.1.13822 WP_048360776.1.81203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]