SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J6H5N2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J6H5N2
Domain Number 1 Region: 12-152
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000000034
Family SMI1/KNR4-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J6H5N2
Sequence length 157
Comment (tr|A0A0J6H5N2|A0A0J6H5N2_9PSED) SMI1 / KNR4 family (SUKH-1) {ECO:0000313|EMBL:SDS28983.1} KW=Complete proteome OX=163011 OS=Pseudomonas lini. GN=SAMN04490191_1125 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MLENTFSNDEAAITPADLDHLESVIGKKLPTPFRNHYLKYNGGVPERTYWVSEDFDEPLE
VVAFKPITGDDSTLLSTYQLMLKKQVLPAHLLPFANDWGGNFFCLNLDTEAVSYFTTDSF
DSDLSPEENQAQSEKLVCSNFLRFVQGLIGEEDLDEE
Download sequence
Identical sequences A0A0J6H5N2
WP_048397464.1.63707 WP_048397464.1.82543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]