SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J6HG60 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J6HG60
Domain Number 1 Region: 9-116
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000523
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0J6HG60
Sequence length 124
Comment (tr|A0A0J6HG60|A0A0J6HG60_9PSED) Uncharacterized protein {ECO:0000313|EMBL:SDT50918.1} KW=Complete proteome OX=163011 OS=Pseudomonas lini. GN=SAMN04490191_4853 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSFYLKIQNRQDFSYPENFITTISLSPPIDIEPWWFIAFEDGDVNYWYQALKKLYPKRDL
IPFAKFNANDDIACFDGDDSSGEPKVLIIHAYASEGWELHGTYNNFNEWFSEAIKTHQKW
EKEE
Download sequence
Identical sequences A0A0J6HG60
WP_048394964.1.63707 WP_048394964.1.82543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]