SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J6HR68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J6HR68
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 3.79e-45
Family SMI1/KNR4-like 0.000000225
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0J6HR68
Sequence length 135
Comment (tr|A0A0J6HR68|A0A0J6HR68_9PSED) Cell wall assembly protein {ECO:0000313|EMBL:KMM97083.1} KW=Complete proteome OX=122355 OS=Pseudomonas psychrophila. GN=TU76_21230 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MEEIIEELREKNEPVPVPLELPEEDQLVEIEEQLFIDIPFVFREFLLTVSDVVYGSLEPV
TVTDPQSHTYLPEVAANAWDAGVDRSLIPICQDGDDYYCVEEDGTVVLWSGEEELVTEET
WESVWHWARDVWLES
Download sequence
Identical sequences A0A0J6HR68 A0A1H2J082 S6HRY4
WP_016782918.1.16988 WP_016782918.1.1888 WP_016782918.1.19841 WP_016782918.1.23977 WP_016782918.1.36190 WP_016782918.1.83801 WP_016782918.1.88553 WP_016782918.1.96099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]