SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J6ILQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J6ILQ6
Domain Number 1 Region: 36-128
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000706
Family SMI1/KNR4-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0J6ILQ6
Sequence length 211
Comment (tr|A0A0J6ILQ6|A0A0J6ILQ6_9PSED) Uncharacterized protein {ECO:0000313|EMBL:KMN12759.1} KW=Complete proteome; Reference proteome OX=1608994 OS=Pseudomonas weihenstephanensis. GN=TU86_17355 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MTSLDRLLLISSLPLCEHTPEIFGQTRKLAGKLAGELLGMLLKCNGFYAFESSLHVFPTH
SDQLEIGISDWNDNALWRSAYKGLADECLFFAEDAFGGQFCIKDNSVFTFDPETGELEYL
ANDIEGWARILLSDYEILTGLVLAHQWQKNNGQIPVGKRLLPKVPFVLGGEYSLSNLYLS
DSVRGMKIRADIAHQIKNLPDGAQVKFEIEG
Download sequence
Identical sequences A0A0J6ILQ6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]