SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0J6KNC5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0J6KNC5
Domain Number 1 Region: 4-158
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 1.07e-69
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.000000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0J6KNC5
Sequence length 162
Comment (tr|A0A0J6KNC5|A0A0J6KNC5_9BACI) 5-(carboxyamino)imidazole ribonucleotide mutase {ECO:0000256|HAMAP-Rule:MF_01929} KW=Complete proteome OX=1628207 OS=Lysinibacillus sp. LK3. GN=VK91_18475 OC=Lysinibacillus.
Sequence
MNPKIGVIMGSSSDWETMKHACDILDELQVPYEKKVVSAHRTPDLMFEYAEAARERGIQV
IIAGAGGAAHLPGMVAAKTTLPVIGVPVQSRALNGLDSLLSIVQMPGGVPVATVAIGKAG
ATNAGLLAAQILSTTDAELANKLDARREATKQQVLESTGDLV
Download sequence
Identical sequences A0A0J6KNC5 A0A2I7Z823 D7WP82
WP_004225751.1.17750 WP_004225751.1.18137 WP_004225751.1.48789 WP_004225751.1.88078 WP_004225751.1.93799 WP_004225751.1.96861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]